PDB entry 5dzu

View 5dzu on RCSB PDB site
Description: Structure of potato cathepsin D inhibitor
Class: hydrolase inhibitor
Keywords: Kunitz-type protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2015-09-26, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartic protease inhibitor 11
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dzua_
  • Chain 'B':
    Compound: Aspartic protease inhibitor 11
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dzub_
  • Heterogens: GOL, NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dzuA (A:)
    esplpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvg
    psgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtig
    qadssyfkivklsnfgynllycpitppflcpfcrddnfcakvgvviqngkrrlalvnenp
    ldvlfqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dzuA (A:)
    splpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgp
    sgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtigq
    adssyfkivklsnfgynllycpitppflcpfcrddnfcakvgvviqngkrrlalvnenpl
    dvlfqev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dzuB (B:)
    esplpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvg
    psgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtig
    qadssyfkivklsnfgynllycpitppflcpfcrddnfcakvgvviqngkrrlalvnenp
    ldvlfqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dzuB (B:)
    splpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgp
    sgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtigq
    adssyfkivklsnfgynllycpidnfcakvgvviqngkrrlalvnenpldvlfqev