PDB entry 5dz2

View 5dz2 on RCSB PDB site
Description: Geosmin synthase from Streptomyces coelicolor N-terminal domain complexed with three Mg2+ ions and alendronic acid
Class: lyase
Keywords: terpene, cyclase, geosmin, germacradienol, LYASE
Deposited on 2015-09-25, released 2015-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germacradienol/geosmin synthase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: cyc2, SCO6073, SC9B1.20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dz2a_
  • Chain 'B':
    Compound: Germacradienol/geosmin synthase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: cyc2, SCO6073, SC9B1.20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dz2b_
  • Heterogens: MG, 212, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dz2A (A:)
    mtqqpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllc
    aythpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplddaag
    mpeprnpveagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpvey
    iemrrkvggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqreved
    egelsngvlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltpleva
    avgaytkglqdwqsgghewhmrssrymnkgerplagwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dz2A (A:)
    qpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllcayt
    hpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplgmpeprnp
    veagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpveyiemrrkv
    ggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqrevedegelsng
    vlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltplevaavgaytk
    glqdwqsgghewhmrssrymnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dz2B (B:)
    mtqqpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllc
    aythpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplddaag
    mpeprnpveagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpvey
    iemrrkvggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqreved
    egelsngvlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltpleva
    avgaytkglqdwqsgghewhmrssrymnkgerplagwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dz2B (B:)
    qpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllcayt
    hpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplgmpeprnp
    veagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpveyiemrrkv
    ggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqrevedegelsng
    vlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltplevaavgaytk
    glqdwqsgghewhmrssrymnk