PDB entry 5dyt

View 5dyt on RCSB PDB site
Description: Crystal structure of human butyrylcholinesterase in complex with N-((1-benzylpiperidin-3-yl)methyl)-N-methylnaphthalene-2-sulfonamide
Class: hydrolase
Keywords: human butyrylcholinesterase, AD, alzheimer disease, sulfonamide, hydrolase
Deposited on 2015-09-25, released 2016-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dyta_
  • Chain 'B':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: BCHE, CHE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dytb_
  • Heterogens: NAG, FUC, 5HB, GOL, EDO, UNX, FUL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dytA (A:)
    teddiiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnat
    kyansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfq
    tgtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvq
    kniaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyea
    rnrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfl
    tdmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffp
    gvsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffy
    yfehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygn
    pnetqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dytA (A:)
    diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
    nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
    sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
    aafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
    tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
    pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
    efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
    hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
    tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dytB (B:)
    teddiiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnat
    kyansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfq
    tgtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvq
    kniaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyea
    rnrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfl
    tdmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffp
    gvsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffy
    yfehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygn
    pnetqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dytB (B:)
    iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
    sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
    slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
    afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
    lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
    dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
    fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
    rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
    nnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv