PDB entry 5dym

View 5dym on RCSB PDB site
Description: Crystal structure of a PadR family transcription regulator from hypervirulent Clostridium difficile R20291 - CdPadR_0991 to 1.89 Angstrom resolution
Class: DNA binding protein
Keywords: PadR, wHTH DNA binding domain, Helix turn helix motifs, transcription regulator, PadR-s2, DNA BINDING PROTEIN
Deposited on 2015-09-24, released 2016-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PadR-family transcriptional regulator
    Species: Peptoclostridium difficile (strain R20291) [TaxId:645463]
    Gene: CDR20291_0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dyma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dymA (A:)
    wshpqfekmqlnkevlkgyidilivsilekkdcygyeiakqvrersefelkegtmylalk
    rmesknliksyysneqssggrrkyynltnegkdfleikkqewrfikkvmnqflgevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dymA (A:)
    gyidilivsilekkdcygyeiakqvrerseflkegtmylalkrmesknliksyysneqss
    ggrrkyynltnegkdfleikkqewrfikkvmnqflg