PDB entry 5dxw

View 5dxw on RCSB PDB site
Description: Crystal structure of mouse PD-L1 nanobody
Class: signaling protein
Keywords: IG FOLD, mouse PD-L1 nanobody, SIGNALING PROTEIN
Deposited on 2015-09-24, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PD-L1 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DXW
    Domains in SCOPe 2.07: d5dxwa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5dxwA (A:)
maqvqlvetggglvqpggslrlsctasgftfsmhamtwyrqapgkqrelvavitshgdra
nytdsvrgrftisrdntknmvylqmnslkpedtavyycnvprydswgqgtqvtvssgglp
etgghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5dxwA (A:)
qvqlvetggglvqpggslrlsctasgftfsmhamtwyrqapgkqrelvavitshgdrany
tdsvrgrftisrdntknmvylqmnslkpedtavyycnvprydswgqgtqvtvss