PDB entry 5dw6

View 5dw6 on RCSB PDB site
Description: Succinyl-CoA:acetate CoA-transferase (AarCH6) bound to acetate and the CoA analogue 3'-phosphoadenosine 5'-(O-(N-propyl-R-pantothenamide))pyrophosphate (MX)
Class: transferase
Keywords: Tricarboxylic acid cycle, Transferase, Acidophile, coenzyme analogue
Deposited on 2015-09-22, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:acetate CoA-transferase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X8M7 (Start-504)
      • expression tag (505-513)
    Domains in SCOPe 2.07: d5dw6a1, d5dw6a2, d5dw6a3
  • Chain 'B':
    Compound: Succinyl-CoA:acetate CoA-transferase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dw6b1, d5dw6b2
  • Heterogens: ACT, 0T1, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dw6A (A:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dw6A (A:)
    erirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgeky
    qislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagrav
    qgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihdi
    wdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetakai
    agylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgmla
    mldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamng
    mieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaahv
    dhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkht
    phlltealswhqrfidtgtmlpsslehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dw6B (B:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dw6B (B:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps