PDB entry 5dw5

View 5dw5 on RCSB PDB site
Description: Succinyl-CoA:acetate CoA-transferase (AarCH6) bound to the CoA analogue 3'-phosphoadenosine 5'-(O-(N-propylpantothenamide))pyrophosphate (MX)
Class: transferase
Keywords: Tricarboxylic acid cycle, Transferase, Acidophile
Deposited on 2015-09-22, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:acetate CoA-transferase
    Species: Acetobacter aceti [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X8M7 (Start-504)
      • expression tag (505-513)
    Domains in SCOPe 2.07: d5dw5a1, d5dw5a2, d5dw5a3
  • Chain 'B':
    Compound: Succinyl-CoA:acetate CoA-transferase
    Species: Acetobacter aceti [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dw5b1, d5dw5b2
  • Heterogens: CL, 0T1, ACT, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dw5A (A:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dw5A (A:)
    erirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgeky
    qislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagrav
    qgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihdi
    wdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetakai
    agylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgmla
    mldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamng
    mieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaahv
    dhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkht
    phlltealswhqrfidtgtmlpsslehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dw5B (B:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dw5B (B:)
    erirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgeky
    qislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagrav
    qgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihdi
    wdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetakai
    agylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgmla
    mldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspgiirrlgciamng
    mieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaahv
    dhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkht
    phlltealswhqrfidtgtmlps