PDB entry 5dvz

View 5dvz on RCSB PDB site
Description: Holo TrpB from Pyrococcus furiosus
Class: lyase
Keywords: Type II PLP enzyme, Tryptophan Biosynthesis, EC 4.2.1.20, LYASE
Deposited on 2015-09-21, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dvza_
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dvzb_
  • Chain 'C':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dvzc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dvzd_
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dvzA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvzA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dvzB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvzB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdgqikpthsiapgldyp
    gvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsr
    deiiivnlsgrgdkdldivlkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dvzC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvzC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdgqikpthsiapgldyp
    gvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsr
    deiiivnlsgrgdkdldivlkvsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dvzD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvzD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs