PDB entry 5dvh

View 5dvh on RCSB PDB site
Description: Structure of the Kunitz-type cysteine protease inhibitor PCPI-3 from potato
Class: protease inhibitor
Keywords: Plant Kunitz-family inhibitor, protease inhibitor
Deposited on 2015-09-21, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pcpi-3
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DVH (0-192)
    Domains in SCOPe 2.07: d5dvha_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dvhA (A:)
    vsppvldmdgeplkideeysiisipfgggsvylanlgntkcpngvvqdssggnnnktpvl
    fytmklgshfvsenqdvsikfstsssskscinetvwkvaysivgpthsplrfvitggtfg
    fpgpnnienwfkiekyetgrphsyklrycpsqyicptcqfdcadvglyenkgyarlalnn
    kpypfgfskvnkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvhA (A:)
    vsppvldmdgeplkideeysiisipfgggsvylanlgntkcpngvvqdssnktpvlfytm
    klgshfvsenqdvsikfstkscinetvwkvaysivgpthsplrfvitggtfgfpgpnnie
    nwfkiekyetgrphsyklrycpsqyicptcqfdcadvglyenkgyarlalnnkpypfgfs
    kvnkn