PDB entry 5dtx

View 5dtx on RCSB PDB site
Description: Crystal structure of rsEGFP2 in the fluorescent on-state
Class: fluorescent protein
Keywords: Fluorescent protein, GFP, reversibly switchable, cis chromophore
Deposited on 2015-09-18, released 2016-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Green fluorescent protein
  Species: Aequorea victoria [TaxId:6100]
  Gene: GFP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42212 (19-245)
    • expression tag (0-9)
    • engineered mutation (10)
    • engineered mutation (73)
    • chromophore (74)
    • engineered mutation (76)
    • engineered mutation (170)
    • engineered mutation (213)
    • engineered mutation (238)
  Domains in SCOPe 2.08: d5dtxa1, d5dtxa2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dtxA (A:)
  hhhhhhtdpmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfictt
  gklpvpwptlvttlxvlcfsrypdhmkqhdffksampegyvqertiffkddgnyktraev
  kfegdtlvnrielkgidfkedgnilghkleynynshnvyimadkqkngiksnfkirhnie
  dgsvqladhyqqntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlg
  mdelyk