PDB entry 5dtj

View 5dtj on RCSB PDB site
Description: Crystal Structure of dfp-inhibited mouse acetylcholinesterase in complex with the reactivator SP-134
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase-Hydrolase Inhibitor complex
Deposited on 2015-09-18, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5dtja1, d5dtja2
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dtjb_
  • Heterogens: 5G8

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dtjA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kllsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtjA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dtjB (B:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kllsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtjB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
    dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
    asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
    fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
    ndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls