PDB entry 5dti

View 5dti on RCSB PDB site
Description: Crystal structure of mouse acetylcholinesterase
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-09-18, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (3-544)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5dtia1, d5dtia2
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dtib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dtiA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kllsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtiA (A:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dtiB (B:)
    dpmegredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpws
    gvldattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliw
    iygggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqr
    lalqwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwa
    tvsagearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrf
    sfvpvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisra
    qflagvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagr
    laaqgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlm
    kywtnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflp
    kllsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtiB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
    dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
    asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
    fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
    ndprdspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll