PDB entry 5dss

View 5dss on RCSB PDB site
Description: MP-4 contributes to snake venom neutralization by Mucuna pruriens seeds through stimulation of cross-reactive antibodies
Class: plant protein
Keywords: Plant protein, Protease inhibitor, Echis carinatus (Saw-scale viper), MP-4
Deposited on 2015-09-17, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: mp-4
    Species: Mucuna pruriens [TaxId:157652]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DSS (0-184)
    Domains in SCOPe 2.07: d5dssb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dssB (B:)
    kndaepvidtdgnpllhrgkyyimpsnwgppggglrlgktrnlncpvtvlqdyneaingl
    pvkfnireilprtiftdtelnieftekpncaenrawslfkgddrghkarvgiggsnghpg
    gemlrggfygeqhglrngtyklvfcrdgsstcldvgrygnregrrlglseagelgvgfek
    agggn