PDB entry 5dqy

View 5dqy on RCSB PDB site
Description: A fully oxidized human thioredoxin
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2015-09-15, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5dqya_
  • Heterogens: BEZ, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dqyA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv