PDB entry 5dq0

View 5dq0 on RCSB PDB site
Description: Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
Class: signaling protein
Keywords: Neuropilin, VEGF, signaling protein
Deposited on 2015-09-14, released 2016-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuropilin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: NRP2, VEGF165R2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60462 (Start-158)
      • expression tag (159-161)
    Domains in SCOPe 2.08: d5dq0a1, d5dq0a2
  • Heterogens: ZN, CL, EDO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5dq0A (A:)
ghmfqcnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqv
dlrfltmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndat
evvlnklhaplltrfvrirpqtwhsgialrlelfgcrvtsgs

    Sequence, based on observed residues (ATOM records): (download) 
    >5dq0A (A:)
cnvplgmesgrianeqisasstysdgrwtpqqsrlhgddngwtpnldsnkeylqvdlrfl
tmltaiatqgaisretqngyyvksyklevstngedwmvyrhgknhkvfqanndatevvln
klhaplltrfvrirpqtwhsgialrlelfgcrvtsgs