PDB entry 5dpt

View 5dpt on RCSB PDB site
Description: Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117
Class: protein binding
Keywords: Autophagy, chimeric protein, PROTEIN BINDING
Deposited on 2015-09-14, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1,Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHM1, GABARAPL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4G2 (Start-13)
      • linker (14-15)
    • Uniprot Q9H0R8 (16-End)
    Domains in SCOPe 2.07: d5dpta_
  • Chain 'B':
    Compound: Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1,Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHM1, GABARAPL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4G2 (Start-13)
      • linker (14-15)
    • Uniprot Q9H0R8 (16-End)
    Domains in SCOPe 2.07: d5dptb_
  • Heterogens: MPD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dptA (A:)
    gsvrpqqedewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdld
    krkylvpsdltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyfl
    yvaysdesvygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dptA (A:)
    edewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvp
    sdltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysde
    sv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dptB (B:)
    gsvrpqqedewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdld
    krkylvpsdltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyfl
    yvaysdesvygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dptB (B:)
    dewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvps
    dltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdes
    vyg