PDB entry 5dps

View 5dps on RCSB PDB site
Description: Crystal structure of PLEKHM1 LIR-fused human GABARAP_2-117
Class: protein binding
Keywords: Autophagy, chimeric protein, PROTEIN BINDING
Deposited on 2015-09-14, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family M member 1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHM1, GABARAP,
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4G2 (Start-12)
      • linker (14-15)
      • linker (13-14)
    • Uniprot O95166 (15-End)
    Domains in SCOPe 2.07: d5dpsa_
  • Chain 'B':
    Compound: Pleckstrin homology domain-containing family M member 1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHM1, GABARAP,
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4G2 (Start-12)
      • linker (14-15)
      • linker (13-14)
    • Uniprot O95166 (15-End)
    Domains in SCOPe 2.07: d5dpsb_
  • Chain 'C':
    Compound: Pleckstrin homology domain-containing family M member 1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHM1, GABARAP,
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4G2 (Start-13)
      • linker (15-16)
      • linker (14-15)
    • Uniprot O95166 (16-End)
    Domains in SCOPe 2.07: d5dpsc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dpsA (A:)
    gsvrpqqedewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dpsA (A:)
    dewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvps
    dltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdes
    vy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dpsB (B:)
    gsvrpqqedewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dpsB (B:)
    edewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvp
    sdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysde
    sv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dpsC (C:)
    gsvrpqqedewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dpsC (C:)
    dewvnvgskfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvps
    dltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdes
    v