PDB entry 5dnw

View 5dnw on RCSB PDB site
Description: Crystal structure of KAI2-like protein from Striga (apo state 1)
Class: hydrolase
Keywords: KAI2 Karrikin Striga, HYDROLASE
Deposited on 2015-09-10, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ShKAI2iB
    Species: Striga hermonthica [TaxId:68872]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DNW (0-End)
    Domains in SCOPe 2.07: d5dnwa1, d5dnwa2
  • Heterogens: FMT, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dnwA (A:)
    gplgsmnrveaarnvhivgsgdttvvlghgfgtdqsvwkhlvpylvdsyrvllydnmgag
    stnpeyfhferystlqgyahdllvilhefnirscifvghslsamtgaiasiirpdlfqki
    vmlsasprflntadylggfepadveqlagaieanykswvsgfapmvvggdmdsvavqefs
    rtlfnmrpdiarsvfrtiftsdlrdylgrvtvpchiiqssrdmavpvsvagyihnrvggr
    svvevmnteghlpqlsapevaipvllrhikndids
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dnwA (A:)
    gplgsmnrveaarnvhivgsgdttvvlghgfgtdqsvwkhlvpylvdsyrvllydnmgag
    stnpeyfhferystlqgyahdllvilhefnirscifvghslsamtgaiasiirpdlfqki
    vmlsasprflntadylggfepadveqlagaieanykswvsgfapmvvggdmdsvavqefs
    rtlfnmrpdiarsvfrtiftsdlrdylgrvtvpchiiqssrdmavpvsvagyihnrvggr
    svvevmnteghlpqlsapevaipvllrhikndid