PDB entry 5dmk
View 5dmk on RCSB PDB site
Description: Crystal Structure of IAg7 in complex with RLGL-WE14
Class: immune system
Keywords: Chromogranin A, Type I Diabetes, T cell, fusion protein, IMMUNE SYSTEM
Deposited on
2015-09-08, released
2015-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-11-11, with a file datestamp of
2015-11-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: H-2 class II histocompatibility antigen, A-D alpha chain
Species: Mus musculus [TaxId:10090]
Gene: I-Ag7
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5dmka1, d5dmka2 - Chain 'B':
Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
Species: Mus musculus [TaxId:10090]
Gene: H2-Ab1
Database cross-references and differences (RAF-indexed):
- PDB 5DMK (0-End)
- Uniprot Q31135 (27-211)
- Chain 'C':
Compound: H-2 class II histocompatibility antigen, A-D alpha chain
Species: Mus musculus [TaxId:10090]
Gene: I-Ag7
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5dmkc1, d5dmkc2 - Chain 'D':
Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
Species: Mus musculus [TaxId:10090]
Gene: H2-Ab1
Database cross-references and differences (RAF-indexed):
- PDB 5DMK (0-End)
- Uniprot Q31135 (27-211)
- Chain 'E':
Compound: H-2 class II histocompatibility antigen, A-D alpha chain
Species: Mus musculus [TaxId:10090]
Gene: I-Ag7
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5dmke1, d5dmke2 - Chain 'F':
Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
Species: Mus musculus [TaxId:10090]
Gene: H2-Ab1
Database cross-references and differences (RAF-indexed):
- PDB 5DMK (0-End)
- Uniprot Q31135 (27-211)
- Chain 'G':
Compound: H-2 class II histocompatibility antigen, A-D alpha chain
Species: Mus musculus [TaxId:10090]
Gene: I-Ag7
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5dmkg1, d5dmkg2 - Chain 'H':
Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
Species: Mus musculus [TaxId:10090]
Gene: H2-Ab1
Database cross-references and differences (RAF-indexed):
- PDB 5DMK (0-End)
- Uniprot Q31135 (27-End)
- Heterogens: FLC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5dmkA (A:)
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
Sequence, based on observed residues (ATOM records): (download)
>5dmkA (A:)
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgl
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5dmkC (C:)
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5dmkE (E:)
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
- Chain 'F':
No sequence available.
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>5dmkG (G:)
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
- Chain 'H':
No sequence available.