PDB entry 5dmj

View 5dmj on RCSB PDB site
Description: Structure of the extracellular domain of the CD40 in complex with 3H56-5 DAB
Class: immune system/signaling protein
Keywords: CELL SURFACE RECEPTOR, DOMAIN ANTIBODY, PROTEIN/PROTEIN INTERACTION, IMMUNE SYSTEM-SIGNALING PROTEIN complex
Deposited on 2015-09-08, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25942
      • see remark 999 (130)
      • see remark 999 (157)
  • Chain 'B':
    Compound: 3H65-5 domain antibody (dAb)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMJ
    Domains in SCOPe 2.07: d5dmjb_
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25942
      • see remark 999 (130)
      • see remark 999 (157)
  • Chain 'E':
    Compound: 3H65-5 domain antibody (dAb)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMJ (1-End)
    Domains in SCOPe 2.07: d5dmje_
  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40, TNFRSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25942
      • see remark 999 (130)
      • see remark 999 (157)
  • Chain 'G':
    Compound: 3H65-5 domain antibody (dAb)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMJ
    Domains in SCOPe 2.07: d5dmjg_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dmjB (B:)
    stevqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrt
    yyadsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvssaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dmjB (B:)
    evqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrtyy
    adsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvssa
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5dmjE (E:)
    stevqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrt
    yyadsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvssaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dmjE (E:)
    tevqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrty
    yadsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvs
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5dmjG (G:)
    stevqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrt
    yyadsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvssaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dmjG (G:)
    evqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrtyy
    adsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvss