PDB entry 5dkf

View 5dkf on RCSB PDB site
Description: Reaction of phosphorylated CheY with imidazole 3 of 3
Class: metal binding protein
Keywords: two component signaling, asp to his phosphotransfer, response regulator, receiver domain, METAL BINDING PROTEIN
Deposited on 2015-09-03, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: cheY, Z2936, ECs2592
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE68 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.08: d5dkfa_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: cheY, Z2936, ECs2592
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE68 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.08: d5dkfb_
• Heterogens: MN, BEF, IMD, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dkfA (A:)
  adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
  nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dkfB (B:)
  adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
  nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm