PDB entry 5dk8

View 5dk8 on RCSB PDB site
Description: Human ubiquitin in the P1 space group
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-09-03, released 2015-12-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (2-75)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d5dk8a_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d5dk8b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dk8A (A:)
hhqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrlrg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5dk8B (B:)
hhqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrlrg

    Sequence, based on observed residues (ATOM records): (download) 
    >5dk8B (B:)
hhqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
niqkestlhlvlrlr