PDB entry 5dis

View 5dis on RCSB PDB site
Description: Crystal structure of a CRM1-RanGTP-SPN1 export complex bound to a 113 amino acid FG-repeat containing fragment of Nup214
Class: transport protein
Keywords: FG-repeats, Nucleoporin, Nup214, Exportin, transport protein
Deposited on 2015-09-01, released 2015-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Xpo1, Crm1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (0-171)
      • engineered mutation (61)
    Domains in SCOPe 2.05: d5disb_
  • Chain 'C':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNUPN, RNUT1, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (2-288)
      • linker (0-1)
    Domains in SCOPe 2.05: d5disc1, d5disc2
  • Chain 'D':
    Compound: Maltose-binding periplasmic protein,Nuclear pore complex protein Nup214
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP214, CAIN, CAN, KIAA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (0-355)
      • linker (356-362)
      • linker (365-366)
    • Uniprot P35658 (367-478)
  • Heterogens: PRO, MAL, GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5disB (B:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5disC (C:)
    gsmeelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldy
    vnharrlaeddwtgmeseeenkkddeemdidtvkklpkhyanqlmlsewlidvpsdlgqe
    wivvvcpvgkralivasrgstsaytksgycvnrfssllpggnrrnstakdytildciyne
    vnqtyyvldvmcwrghpfydcqtdfrfywmhsklpeeeglgektklnpfkfvglknfpct
    peslcdvlsmdfpfevdgllfyhkqthyspgstplvgwlrpymvsdvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5disC (C:)
    gsmeelsqalassfsvsqdlnstaaphprlkskyssleqserrrrllelqkskrldyvnh
    arrlaeddwtgmklpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgsts
    aytksgycvnrfssllpggnrrakdytildciynevnqtyyvldvmcwrghpfydcqtdf
    rfywmhsklpeeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkq
    thyspgstplvgwlrpymvsdvlg
    

  • Chain 'D':
    No sequence available.