PDB entry 5dgx

View 5dgx on RCSB PDB site
Description: 1.73 Angstrom resolution crystal structure of the ABC-ATPase domain (residues 357-609) of lipid A transport protein (msbA) from Francisella tularensis subsp. tularensis SCHU S4 in complex with ADP
Class: transport protein
Keywords: Lipid A transport protein, ABC transporter, ATP-binding and membrane protein, Francisella tularensis subsp. tularensis SCHU S4, CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, TRANSPORT PROTEIN
Deposited on 2015-08-28, released 2015-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Francisella tularensis subsp. tularensis (strain FSC 198) [TaxId:393115]
    Gene: msbA, FTF0109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5dgxa_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dgxA (A:)
    snaeketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttl
    tsiisrfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafglsrev
    seeevidalkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifd
    eatsaldneservvqqalesltkscttiviahrlstvenadkivvmdggrvvesgkhqel
    leqgglytrlyqsglq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dgxA (A:)
    ketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttltsii
    srfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafgevseeevid
    alkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifdelesltk
    scttiviahrlstvenadkivvmdggrvvesgkhqelleqgglytrlyqsglq