PDB entry 5dgd

View 5dgd on RCSB PDB site
Description: Benzoylformate decarboxylase F464I and A460V mutant from Pseudomonas putida
Class: lyase
Keywords: benzoylformate decarboxylase, thiamin diphosphate, lyase
Deposited on 2015-08-27, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-523)
      • engineered mutation (458)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d5dgda1, d5dgda2, d5dgda3
  • Heterogens: MG, CA, TDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dgdA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygvlrwiagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvs