PDB entry 5dgc

View 5dgc on RCSB PDB site
Description: Reaction of phosphorylated CheY with imidazole 2 of 3
Class: metal binding protein
Keywords: two component signaling, asp to his phosphotransfer, response regulator, receiver domain, METAL BINDING PROTEIN
Deposited on 2015-08-27, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: cheY, Z2936, ECs2592
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE68 (0-127)
      • engineered mutation (12)
      • engineered mutation (57)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5dgca_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: cheY, Z2936, ECs2592
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE68 (0-127)
      • engineered mutation (12)
      • engineered mutation (57)
      • engineered mutation (87)
    Domains in SCOPe 2.07: d5dgcb_
  • Heterogens: BEF, MN, IMD, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dgcA (A:)
    adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
    nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dgcB (B:)
    adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
    nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm