PDB entry 5dej

View 5dej on RCSB PDB site
Description: Transthyretin natural mutant A19D
Class: transport protein
Keywords: transthyretin, immunoglobulin-like, transport protein, extracellular, hormone-binding protein
Deposited on 2015-08-25, released 2016-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (9)
    Domains in SCOPe 2.08: d5deja_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered mutation (9)
    Domains in SCOPe 2.08: d5dejb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dejA (A:)
    cplmvkvlddvrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dejB (B:)
    cplmvkvlddvrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dejB (B:)
    cplmvkvlddvrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn