PDB entry 5ddk

View 5ddk on RCSB PDB site
Description: Succinyl-CoA:acetate CoA-transferase (AarCH6-N347A) in complex with CoA
Class: transferase
Keywords: Tricarboxylic acid cycle, Transferase, Acidophile
Deposited on 2015-08-25, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA hydrolase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X8M7 (Start-504)
      • engineered mutation (346)
      • expression tag (505-512)
    Domains in SCOPe 2.07: d5ddka1, d5ddka2, d5ddka3
  • Chain 'B':
    Compound: Acetyl-CoA hydrolase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: AZ09_02565
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A063X8M7 (Start-504)
      • engineered mutation (346)
    Domains in SCOPe 2.07: d5ddkb1, d5ddkb2
  • Heterogens: CL, COA, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ddkA (A:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsaspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ddkA (A:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsaspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlpsslehhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ddkB (B:)
    mterirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrge
    kyqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagr
    avqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegih
    diwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetak
    aiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgm
    lamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsaspgiirrlgciam
    ngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaa
    hvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgk
    htphlltealswhqrfidtgtmlpsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ddkB (B:)
    terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
    yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
    vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
    iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrnapfaapdetaka
    iagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlvgyseviqdgml
    amldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsaspgiirrlgciamn
    gmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakggkisaivpmaah
    vdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyfdralknsfgkh
    tphlltealswhqrfidtgtmlps