PDB entry 5dd7

View 5dd7 on RCSB PDB site
Description: Structure of thiamine-monophosphate kinase from Acinetobacter baumannii in complex with AMPPNP and thiamine-monophosphate
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2015-08-24, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dd7a1, d5dd7a2
  • Chain 'B':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dd7b1, d5dd7b2
  • Heterogens: ANP, MG, K, EDO, TPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dd7A (A:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfaqqrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dd7A (A:)
    maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
    gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
    qgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldypt
    prcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrw
    qyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihg
    yqhfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dd7B (B:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfaqqrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dd7B (B:)
    maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
    gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
    qgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldypt
    prcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrw
    qyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihg
    yqhfa