PDB entry 5dcl

View 5dcl on RCSB PDB site
Description: Structure of a lantibiotic response regulator: N terminal domain of the nisin resistance regulator NsrR
Class: signaling protein
Keywords: Antimicrobial peptide, lantibiotic, nisin, resistance, regulation, two component system, signaling protein
Deposited on 2015-08-24, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PhoB family transcriptional regulator
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: DK41_05180, EN72_05470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dcla_
  • Chain 'B':
    Compound: PhoB family transcriptional regulator
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Gene: DK41_05180, EN72_05470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dclb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dclA (A:)
    msqeqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpy
    fngfywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
    rsqqfiqqeltfggftltregllssqdkevilsptenkilsillmhpkqvvskesllekl
    wendsfidqntlnvnmtrlrkkivpigfdyihtvrgvgyllqdpnsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dclA (A:)
    eqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpyfng
    fywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dclB (B:)
    msqeqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpy
    fngfywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr
    rsqqfiqqeltfggftltregllssqdkevilsptenkilsillmhpkqvvskesllekl
    wendsfidqntlnvnmtrlrkkivpigfdyihtvrgvgyllqdpnsssvdklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dclB (B:)
    eqgkiyiveddmtivsllkdhlsasyhvssvsnfrdvkqeiiafqpdlilmditlpyfng
    fywtaelrkfltipiifisssndemdmvmalnmggddfiskpfslavldakltailr