PDB entry 5dbn

View 5dbn on RCSB PDB site
Description: Crystal structure of AtoDA complex
Class: transferase
Keywords: protein complex, acetoacetyl-CoA transferase, protein binding, TRANSFERASE
Deposited on 2015-08-21, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetate CoA-transferase subunit alpha
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoD, b2221, JW2215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dbna_
  • Chain 'B':
    Compound: Acetate CoA-transferase subunit beta
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoA, b2222, JW2216
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Acetate CoA-transferase subunit alpha
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoD, b2221, JW2215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dbnc_
  • Chain 'D':
    Compound: Acetate CoA-transferase subunit beta
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoA, b2222, JW2216
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Acetate CoA-transferase subunit alpha
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoD, b2221, JW2215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dbne_
  • Chain 'F':
    Compound: Acetate CoA-transferase subunit beta
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoA, b2222, JW2216
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Acetate CoA-transferase subunit alpha
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoD, b2221, JW2215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dbng_
  • Chain 'H':
    Compound: Acetate CoA-transferase subunit beta
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: atoA, b2222, JW2216
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, PEG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dbnA (A:)
    smktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdt
    gigplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggflt
    ptgvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplia
    laaditlvepdelvetgelqpdhivtpgavidhiivsqesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbnA (A:)
    ktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgi
    gplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltpt
    gvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnpliala
    aditlvepdelvetgelqpdhivtpgavidhiivs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dbnC (C:)
    smktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdt
    gigplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggflt
    ptgvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplia
    laaditlvepdelvetgelqpdhivtpgavidhiivsqesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbnC (C:)
    ktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgi
    gplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltpt
    gvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnpliala
    aditlvepdelvetgelqpdhivtpgavidhiivs
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5dbnE (E:)
    smktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdt
    gigplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggflt
    ptgvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplia
    laaditlvepdelvetgelqpdhivtpgavidhiivsqesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbnE (E:)
    tklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgig
    plivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltptg
    vgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplialaa
    ditlvepdelvetgelqpdhivtpgavidhiiv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5dbnG (G:)
    smktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdt
    gigplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggflt
    ptgvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplia
    laaditlvepdelvetgelqpdhivtpgavidhiivsqesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dbnG (G:)
    tklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgig
    plivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltptg
    vgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplialaa
    ditlvepdelvetgelqpdhivtpgavidhiivsq
    

  • Chain 'H':
    No sequence available.