PDB entry 5db5

View 5db5 on RCSB PDB site
Description: Crystal structure of PLP-bound E. coli SufS (cysteine persulfide intermediate) in space group P21
Class: transferase, lyase
Keywords: cysteine desulfurase, pyridoxal 5'-phosphate (PLP), NifS protein family, protein binding, TRANSFERASE, LYASE
Deposited on 2015-08-20, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: sufS, csdB, ynhB, b1680, JW1670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5db5a_
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Escherichia coli DH5[alpha] [TaxId:668369]
    Gene: sufS, csdB, ynhB, b1680, JW1670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5db5b_
  • Heterogens: PLP, EDO, CYS, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5db5A (A:)
    smifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgih
    tlsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiis
    qmehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgt
    enplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvk
    eallqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgl
    nniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavr
    tghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5db5A (A:)
    fsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtls
    aqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqme
    hhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgtenp
    laemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkeal
    lqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnni
    aeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtgh
    hcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5db5B (B:)
    smifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgih
    tlsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiis
    qmehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgt
    enplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvk
    eallqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgl
    nniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavr
    tghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5db5B (B:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg