PDB entry 5day

View 5day on RCSB PDB site
Description: The structure of NAP1-Related Protein(NRP1) in Arabidopsis
Class: chaperone
Keywords: histone chaperone, NAP1-Related protein, transcriptional activation, CHAPERONE
Deposited on 2015-08-20, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAP1-related protein 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NRP1, NFA6, At1g74560, F1M20.24
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CA59 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d5daya1, d5daya2
  • Chain 'B':
    Compound: NAP1-related protein 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NRP1, NFA6, At1g74560, F1M20.24
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CA59 (1-207)
      • expression tag (0)
    Domains in SCOPe 2.06: d5dayb1, d5dayb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dayA (A:)
    snleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsi
    pgfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedak
    ltktftfleegttkitatpikwkegkglpngvnhddkkgnkralpeesfftwftdaqhke
    dagdeihdevadiikedlwsnpltyfnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dayA (A:)
    snleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsi
    pgfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedak
    ltktftflegttkitatpikwkegsfftwfthdevadiikedlwsnpltyfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dayB (B:)
    snleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsi
    pgfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedak
    ltktftfleegttkitatpikwkegkglpngvnhddkkgnkralpeesfftwftdaqhke
    dagdeihdevadiikedlwsnpltyfnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dayB (B:)
    snleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsi
    pgfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedak
    ltktftfleegttkitatpikwksfftwftdadevadiikedlwsnpltyfnn