PDB entry 5dad

View 5dad on RCSB PDB site
Description: Crystal Structure of Human KEAP1 BTB Domain in Complex with Small Molecule TX64014
Class: transcription
Keywords: KEAP1, Trascription Regulation, BTB domain, Cysteine Modification, C1-(R)-Cys151 adduct, TRANSCRIPTION
Deposited on 2015-08-19, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KEAP1, INRF2, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dada_
  • Heterogens: TX6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dadA (A:)
    gshmasnrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlas
    sspvfkamftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmy
    qidsvvracsdflvqqldps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dadA (A:)
    rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
    mftmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvracsdflv
    qql