PDB entry 5da4

View 5da4 on RCSB PDB site
Description: Structure of a nanobody recognizing the fumarate transporter SLC26Dg
Class: immune system
Keywords: Membrane transport protein, nanobody complex, immune system
Deposited on 2015-08-19, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody recognizing the membrane protein SLC26Dg
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DA4 (Start-124)
    Domains in SCOPe 2.07: d5da4a_
  • Chain 'B':
    Compound: Nanobody recognizing the membrane protein SLC26Dg
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DA4 (Start-124)
    Domains in SCOPe 2.07: d5da4b_
  • Chain 'C':
    Compound: Nanobody recognizing the membrane protein SLC26Dg
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DA4 (Start-124)
    Domains in SCOPe 2.07: d5da4c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5da4A (A:)
    gpsqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggk
    synadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtq
    vtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da4A (A:)
    sqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksy
    nadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvt
    vss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5da4B (B:)
    gpsqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggk
    synadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtq
    vtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da4B (B:)
    sqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksy
    nadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvt
    vss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5da4C (C:)
    gpsqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggk
    synadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtq
    vtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5da4C (C:)
    sqvqlqesggglvqaggslrlscaasgrtfssdvmgwfrqapgkerefvaavtrsggksy
    nadsvkgrftisrdnakntvslqmnslkpedtavyycaagdtaitswygydywgqgtqvt
    vss