PDB entry 5d9u

View 5d9u on RCSB PDB site
Description: Structure of thiamine-monophosphate kinase from Acinetobacter baumannii in complex with adenosine diphosphate (ADP) and thiamine diphosphate (TPP), orthorhombic crystal form
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2015-08-19, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9ua1, d5d9ua2
  • Chain 'B':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d9ub1, d5d9ub2
  • Heterogens: NA, MG, ADP, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d9uA (A:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9uA (A:)
    aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig
    wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq
    gphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptp
    rcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwq
    yalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgy
    qhfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d9uB (B:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9uB (B:)
    maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
    gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
    qgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldypt
    prcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrw
    qyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihg
    yqhf