PDB entry 5d9o

View 5d9o on RCSB PDB site
Description: Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose
Class: hydrolase
Keywords: endo-beta-glucanase/endo-xyloglucanase, GLYCOSYL HYDROLASE FAMILY 5, MIXED ALPHA-BETA, TIM BARREL, HYDROLASE
Deposited on 2015-08-18, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06842 (Start-352)
      • engineered mutation (279)
    Domains in SCOPe 2.06: d5d9oa_
  • Chain 'B':
    Compound: B-1,4-endoglucanase
    Species: Prevotella bryantii [TaxId:77095]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06842 (Start-352)
      • engineered mutation (279)
    Domains in SCOPe 2.06: d5d9ob_
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d9oA (A:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigaygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9oA (A:)
    tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
    navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
    tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
    qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
    ntkttwdsechntlteifsalskkfttipyiigaygthgesdisvsksspaekiklaadq
    aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d9oB (B:)
    minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtf
    lmqngfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsg
    awikadtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgye
    alnnyaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsy
    dpwnffntkttwdsechntlteifsalskkfttipyiigaygthgesdisvsksspaeki
    klaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d9oB (B:)
    tymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngf
    navripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikad
    tdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnnya
    qdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnff
    ntkttwdsechntlteifsalskkfttipyiigaygthgesdisvsksspaekiklaadq
    aadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn