PDB entry 5d8y

View 5d8y on RCSB PDB site
Description: 2.05A resolution structure of iron bound BfrB (L68A E81A) from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: ELECTRON TRANSPORT, IRON STORAGE, iron binding, iron mobilization, OXIDOREDUCTASE
Deposited on 2015-08-18, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8ya_
  • Chain 'B':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yb_
  • Chain 'C':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yc_
  • Chain 'D':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yd_
  • Chain 'E':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8ye_
  • Chain 'F':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yf_
  • Chain 'G':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yg_
  • Chain 'H':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yh_
  • Chain 'I':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yi_
  • Chain 'J':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yj_
  • Chain 'K':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yk_
  • Chain 'L':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yl_
  • Chain 'M':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8ym_
  • Chain 'N':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yn_
  • Chain 'O':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yo_
  • Chain 'P':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yp_
  • Chain 'Q':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yq_
  • Chain 'R':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yr_
  • Chain 'S':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8ys_
  • Chain 'T':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yt_
  • Chain 'U':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yu_
  • Chain 'V':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yv_
  • Chain 'W':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yw_
  • Chain 'X':
    Compound: Ferroxidase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (67)
      • engineered mutation (80)
    Domains in SCOPe 2.05: d5d8yx_
  • Heterogens: FE2, ACT, K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d8yA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d8yB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5d8yC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5d8yD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5d8yE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5d8yF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5d8yG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5d8yH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5d8yI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5d8yJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5d8yK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5d8yL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5d8yM (M:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yM (M:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5d8yN (N:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yN (N:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5d8yO (O:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yO (O:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5d8yP (P:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yP (P:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5d8yQ (Q:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yQ (Q:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5d8yR (R:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yR (R:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5d8yS (S:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yS (S:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5d8yT (T:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yT (T:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5d8yU (U:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yU (U:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5d8yV (V:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yV (V:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5d8yW (W:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yW (W:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5d8yX (X:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d8yX (X:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilflegapnlqdlgklligantqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenylqshmhe