PDB entry 5d7c

View 5d7c on RCSB PDB site
Description: Crystal structure of the ATP binding domain of S. aureus GyrB complexed with a ligand
Class: isomerase/isomerase inhibitor
Keywords: DNA gyrase, GyrB, ligand, structure-based design, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2015-08-13, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d7ca_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d7cb_
  • Heterogens: MPD, 57W, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d7cA (A:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d7cA (A:)
    agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
    wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
    qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
    eenvredsyhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d7cB (B:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d7cB (B:)
    qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
    tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhyeg