PDB entry 5d78

View 5d78 on RCSB PDB site
Description: Structure of RRM3 Domain of Mip6 at 1.25 A Resolution
Class: RNA binding protein
Keywords: RNA Binding Protein, RNA Binding Domain
Deposited on 2015-08-13, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein MIP6
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MIP6, YHR015W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38760 (6-80)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5d78a1, d5d78a2
  • Heterogens: BME, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5d78A (A:)
    gplgsmktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeesk
    kaqkclnktifknhtiwvgpg