PDB entry 5d6q

View 5d6q on RCSB PDB site
Description: Crystal structure of the ATP binding domain of S. aureus GyrB complexed with a ligand
Class: isomerase/isomerase inhibitor
Keywords: DNA gyrase, GyrB, ligand, structure-based design, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2015-08-12, released 2015-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d6qa_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: GYRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d6qb_
  • Heterogens: MPD, 57V, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d6qA (A:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6qA (A:)
    agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
    wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
    qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
    eenvredsyhye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d6qB (B:)
    gsvtalsdvnntdnygagqiqvlegleavrkrpgmyigstserglhhlvweivdnsidea
    lagyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyv
    hrnetiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirel
    aflnkgiqitlrderdeenvredsyhyeggik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d6qB (B:)
    qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
    tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhyeg