PDB entry 5d6j

View 5d6j on RCSB PDB site
Description: Crystal structure of a mycobacterial protein
Class: ligase/protein binding
Keywords: Mycobacterium smegmatis, LIGASE-PROTEIN BINDING complex
Deposited on 2015-08-12, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA synthase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: fadD32, MSMEG_6393, MSMEI_6225
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SMT3, YDR510W, D9719.15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d6jb_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5d6jB (B:)
ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
ldmedndiieahre