PDB entry 5d4q

View 5d4q on RCSB PDB site
Description: Crystal structure of GASDALIE IgG1 Fc
Class: immune system
Keywords: ADCC, IgG Fc, IMMUNE SYSTEM
Deposited on 2015-08-08, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (13)
      • engineered mutation (104)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5d4qa1, d5d4qa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (13)
      • engineered mutation (104)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5d4qb1, d5d4qb2
  • Heterogens: NAG, BMA, MAN, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d4qA (A:)
    cppcpapellagpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d4qA (A:)
    gpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d4qB (B:)
    cppcpapellagpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d4qB (B:)
    gpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls