PDB entry 5d3y

View 5d3y on RCSB PDB site
Description: Crystal Structure of the P-Rex1 PH domain with Inositol-(1,3,4,5)-Tetrakisphosphate Bound
Class: lipid binding protein
Keywords: pleckstrin homology domain, beta sandwich, phosphatidylinositol-binding, LIPID BINDING PROTEIN
Deposited on 2015-08-06, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PREX1, KIAA1415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d3ya_
  • Chain 'B':
    Compound: Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PREX1, KIAA1415
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5d3yb_
  • Heterogens: 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d3yA (A:)
    gefeklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyc
    krksrvtgskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwki
    hntaknkwfvcmaktaeekqkwldaiirereqreslklgmerdayvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d3yA (A:)
    aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvs
    lyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktaeekqkw
    ldaiirereqreslkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d3yB (B:)
    gefeklealeqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyc
    krksrvtgskkstkrtksingslyifrgrintevmevenvedgtadyhsngytvtngwki
    hntaknkwfvcmaktaeekqkwldaiirereqreslklgmerdayvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d3yB (B:)
    aleqlqshiegwegsnltdictqlllqgtllkisagniqerafflfdnllvyckrksrvs
    lyifrgrintevmevenvedgtadyhsngytvtngwkihntaknkwfvcmaktaeekqkw
    ldaiirereqreslkl