PDB entry 5d2c

View 5d2c on RCSB PDB site
Description: Reaction of phosphorylated CheY with imidazole 1 of 3
Class: metal binding protein
Keywords: two component signaling, asp to his phosphotransfer, response regulator, receiver domain, METAL BINDING PROTEIN
Deposited on 2015-08-05, released 2016-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
No data on structure quality are available

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: cheY, Z2936, ECs2592
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE68 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.06: d5d2ca_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: cheY, Z2936, ECs2592
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE68 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.06: d5d2cb_
• Heterogens: MN, BEF, IMD, GOL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5d2cA (A:)
  adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
  nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5d2cB (B:)
  adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
  nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm