PDB entry 5d22

View 5d22 on RCSB PDB site
Description: Structure of ovine granulocyte-macrophage colony-stimulating factor
Class: cytokine
Keywords: Signaling Protein, recombinant proteins, cytokine immunology, cytokine
Deposited on 2015-08-05, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granulocyte-macrophage colony-stimulating factor
    Species: Ovis aries [TaxId:9940]
    Gene: CSF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d22a_
  • Chain 'B':
    Compound: granulocyte-macrophage colony-stimulating factor
    Species: Ovis aries [TaxId:9940]
    Gene: CSF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5d22b_
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5d22A (A:)
    aptrqpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrle
    lykqglrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfd
    cwepvqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d22A (A:)
    qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
    glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5d22B (B:)
    aptrqpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrle
    lykqglrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfd
    cwepvqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5d22B (B:)
    qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
    glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep
    v