PDB entry 5d0i

View 5d0i on RCSB PDB site
Description: Structure of RING finger protein 165
Class: metal binding protein
Keywords: RING finger protein, METAL BINDING PROTEIN
Deposited on 2015-08-03, released 2015-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RING finger protein 165
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF165
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6ZSG1
• Chain 'B':
  Compound: RING finger protein 165
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF165
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6ZSG1
  Domains in SCOPe 2.08: d5d0ib_
• Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5d0iB (B:)
  gplgsgavqntierftfphkykkrrpqdgkgkkdegeesdtdekcticlsmledgedvrr
  lpcmhlfhqlcvdqwlamskkcpicrvdietqlgads
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5d0iB (B:)
  ekcticlsmleedvrrlpcmhlfhqlcvdqwlamskkcpicrvdietqlga