PDB entry 5czg

View 5czg on RCSB PDB site
Description: Crystal Structure Analysis of hypothetical bromodomain Tb427.10.7420 from Trypanosoma brucei in complex with bromosporine
Class: gene regulation
Keywords: Structural Genomics Consortium, SGC, Hypothetical bromodomain, Bromosporine, GENE REGULATION
Deposited on 2015-07-31, released 2015-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Bromodomain
    Species: Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) [TaxId:679716]
    Gene: TbgDal_X9100
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0A3H5 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d5czga_
  • Heterogens: NA, BMF, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5czgA (A:)
    gmsknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdg
    iekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5czgA (A:)
    gmsknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdg
    iekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv