PDB entry 5czb

View 5czb on RCSB PDB site
Description: hcv ns5b in complex with ligand idx17119-5
Class: replication
Keywords: HCV POLYMERASE, Idenix, inhibitor, PROTEROS BIOSTRUCTURES GMBH, replication
Deposited on 2015-07-31, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS5b
    Species: Hepatitis C virus subtype 1b [TaxId:31647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92972 (1-562)
      • expression tag (0)
    Domains in SCOPe 2.07: d5czba1, d5czba2
  • Chain 'B':
    Compound: NS5b
    Species: Hepatitis C virus subtype 1b [TaxId:31647]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5czbb_
  • Heterogens: 55W, GOL, MES, PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5czbA (A:)
    ssmsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqv
    lddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhi
    rsvwedlledtetpidttimaksevfcvqpekggrkparlivfpdlgvrvcekmalydvv
    stlpqavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesi
    yqccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylka
    taacraaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeyd
    lelitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptl
    warmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsysp
    geinrvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpi
    paasqldlsgwfvagysggdiyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5czbA (A:)
    ssmsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqv
    lddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhi
    rsvwedlledtetpidttimaksevfcvqpgrkparlivfpdlgvrvcekmalydvvstl
    pqavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesiyqc
    cdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkataa
    craaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeydlel
    itscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptlwar
    milmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsyspgei
    nrvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpipdl
    sgwfvagysggdiyh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5czbB (B:)
    ssmsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqv
    lddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhi
    rsvwedlledtetpidttimaksevfcvqpekggrkparlivfpdlgvrvcekmalydvv
    stlpqavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesi
    yqccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylka
    taacraaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeyd
    lelitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptl
    warmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsysp
    geinrvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpi
    paasqldlsgwfvagysggdiyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5czbB (B:)
    smsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhir
    svwedlledtetpidttimaksevfcvqpgrkparlivfpdlgvrvcekmalydvvstlp
    qavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesiyqcc
    dlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkataac
    raaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeydleli
    tscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptlwarm
    ilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsyspgein
    rvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpipaas
    dlsgwfvagysggdiyh