PDB entry 5cyt

View 5cyt on RCSB PDB site
Description: refinement of myoglobin and cytochrome c
Deposited on 1988-01-14, released 1989-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.159
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Domains in SCOP 1.55: d5cytr_

PDB Chain Sequences:

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5cytR (R:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats